scenerockers.net


Update This Data Now

Following is a historical and current data for seo and keywords of the site Scenerockers.net. This domain uses the server setup placed in and operated by the provider which is Relians Ltd. Google and alexa ranked this website as 0 and 232984. The pagerank values of Scenerockers.net are 0 out of 10 points. The complete setup of Scenerockers.net is under control of the organization named as Moscow PoP. We estimated the average values of this domain in the data given below. The ip name address or internet protocol address of this site currently being used on its server is 81.17.16.8. This ip address tells its origin, country , city and state as well as its geographical location on map can also be tracked by its ip. Moscow is the city in which the server setup of this domain is being controlled. and Russian Federation is the country of this domain, and the country code used for this country is RU. If we look its position according to the longitude and latitude positions then we find them as 37.6156 and 55.7522. Below you can find the more information about this domain.

Analysis of Scenerockers.net

Scenerockers.net Server Information & SEO

Importance of this data: This data relates to seo, a search engine optimization which means that a website owner must take care of some things which are important to improve their results in SE(search engines). So SEO generally relates to using words which highly match user queries in search results of search engines. or SERPS. A content written with some uniqueness can surely gain seo ranking to a better position in results. Following data includes seo data which includes pagerank (an importance given to a domain name from google) . Pagerank is given in points from 1 to 10. This points are given based on a site's content and site's popularity among the internet. The website with better page rank means better ranking in search results. Google mostly focuses to rank top pagerank domains on top and sorts them by other ranking factors too. Other seo information shown below includes alexa rank, a world ranking of Scenerockers.net and alexa backlinks which are detected by alexa bot ( a bot crawling the web for finding different seo data of domains.)
Google Pagerank :
Alexa Rank : 232984 visit Alexa
Webserver : Apache/2.2.20 (Unix

Scenerockers.net Meta Information

Importance of this data: Meta information of a domain includes the general information which is almost provided in the head section of each website on the net. This information mostly includes the title of the page, the short description of a page content, i.e the short overview of a content located on page. This description helps the search engines to show information about the particular page to users in their search reults. Keywords are also included in the meta information. Keywords includes a set of words which includes words which shows the page content. Keywords are also meant to describe the words included in the page content. This set of words includes most important keywords of the page.
Website title:

SceneRockers.Net! - Download Tamil Hindi Telugu Movies

Description: Isaithai.Com Ithu Oru Isaiyin Thai Madi - Tamil Hindi Telugu Malayalam - No1 Entertainment Paradise
Keywords: isaithaiteamistteam istist kingtorrentsnew tamil moviestamil mp3shigh quality ripsvijayajithsuryarajinikamalendiranvettaikaransurakavalkaranmadrasapatinamayngarandvddvd-ripvcdfirst on nettc1cdripHD 720ptamilhinditelugumalayalamdubbed tamil moviesanushkasimran.sherinkathal solla vanthen.enavaleyaradi nee mohinisanthosh subramaniyamtv showstamil-blurays1080p120pisaithaicreditsithuoruisaiyinthaimadiaudiosongsvideosongsgallerycinema postersnanbanendhirantamilwiretamilkeygoogleokokoru kal oru kannaditamil torrentsdownloadwatch onlinetamil moviesvadivelu tamil songsblurays ayngarandvdsayngaran mp3 songssearch tamil moviestamil torrent movie music dvd-r mp3 tamiltorrent hindi movie serial hindi movies free new movies free movie tamil torrents old movies new movie dvdrip

Scenerockers.net Server Location

Importance of this data: Server location means that specific location on which the backend working of the website's server is being done. The whole setup of that domain is situated in that location which is also known as server location. The location of the server is important because some websites includes a content which is not permitted to view in specific region so that type of content cannot be run in the region of the particular location.
ISP: Relians Ltd IP: 81.17.16.8
City: Moscow Country: Russian Federation(RU)
Latitude: 55.7522 Longitude: 37.6156

Scenerockers.net Backlinks

Importance of this data:

Backlinks, a very powerful seo factor which is used by search engines to rank the sites or domains. The number of backlinks shows the importance of the domain to the search engine. Because a website with a huge number of inlinks is considered a better site and more important and popular. The seo experts mostly recommends the backlinking by placing the links of sites on the different domains with high page ranks. An important search engine google quickly finds the site whose link is placed on a high pagerank site. Because the higher the pagerank the more important it is to google.

Alexa : 10 visit Alexa

More Websites On IP: 81.17.16.8

Importance of this data:

Ip address indicates internet protocol address, which is used by a domain to identify itself among the internet. A single ip address can be used by multiple domains because the ip address verifies the webserver that it is sending data to correct location. The following list of links includes the websites which are using the ip address of Scenerockers.net. These websites are also using the webserver of Scenerockers.net.

toyama-site.com | mysamp.de

Scenerockers.net Traffic Distribution On Countries

Importance of this data:

The internet users are divided among the different countries from which they are visiting the websites. These countries are identified by the ip addresses of the users visiting Scenerockers.net/ Every country has its unique list of ip addresses being used by that country. And those ip addresses can't be used in any other countries. The following list contains the list of the countries whose users are visiting Scenerockers.net. The graph shows the number of users by the highest to lowest distrbution.

Traffic Statistics By country Unavailable

30 Most Popular keywords in Scenerockers.net

Importance of this data:

The internet users are divided among the different countries from which they are visiting the websites. These countries are identified by the ip addresses of the users visiting Scenerockers.net/ Every country has its unique list of ip addresses being used by that country. And those ip addresses can't be used in any other countries. The following list contains the list of the countries whose users are visiting Scenerockers.net. The graph shows the number of users by the highest to lowest distrbution.

No Data Found.

10 Most Popular keywords in Scenerockers.net

Importance of this data:

The internet users are divided among the different countries from which they are visiting the websites. These countries are identified by the ip addresses of the users visiting Scenerockers.net/ Every country has its unique list of ip addresses being used by that country. And those ip addresses can't be used in any other countries. The following list contains the list of the countries whose users are visiting Scenerockers.net. The graph shows the number of users by the highest to lowest distrbution.

No Data Found.

Popular Pages of Scenerockers.net

Importance of this data:

The internet users are divided among the different countries from which they are visiting the websites. These countries are identified by the ip addresses of the users visiting Scenerockers.net/ Every country has its unique list of ip addresses being used by that country. And those ip addresses can't be used in any other countries. The following list contains the list of the countries whose users are visiting Scenerockers.net. The graph shows the number of users by the highest to lowest distrbution.

No Data Found.

Scenerockers.net Traffic Graphs

Importance of this data:

Different Companies are working to collect the data of the users which are visiting the different websites on the net. These companies have their own add-ons for different browsers and they collect the geographic data of users by gathering the websites they are visiting and then categorizing them according to their locations and the keywords they are using to find certain websites on the internet in search engines. These companies include some most popular companies like alexa, quantcast and compete.

Alexa Reach Rank Alexa Daily Reach Graph
Alexa Traffic Rank Alexa Traffic Graph
Compete Rank Compete Graph
Quantcast Rank Quantcast Graph

HTTP Headers of Scenerockers.net

Importance of this data:

Every website's webserver sends the specific data to the client which is requesting to open webpage of a domain. This data is known as headers of a site. Headers includes information which tells browser of client that how to behave with the webpage of the domain. The current date of server, the expiry date of the page, redirect location in case of redirect. And other information.

HTTP/1.1 301 Moved Permanently
Date: Tue, 14 Aug 2012 19:58:41 GMT
Server: Apache/2.2.20 (Unix) mod_ssl/2.2.20 OpenSSL/0.9.8e-fips-rhel5 mod_auth_passthrough/2.1 mod_bwlimited/1.4 FrontPage/5.0.2.2635
Location: http://www.scenerockers.net/forums
Content-Type: text/html; charset=iso-8859-1

HTTP/1.1 301 Moved Permanently
Date: Tue, 14 Aug 2012 19:58:41 GMT
Server: Apache/2.2.20 (Unix) mod_ssl/2.2.20 OpenSSL/0.9.8e-fips-rhel5 mod_auth_passthrough/2.1 mod_bwlimited/1.4 FrontPage/5.0.2.2635
Location: http://www.scenerockers.net/forums/
Content-Type: text/html; charset=iso-8859-1

HTTP/1.1 200 OK
Date: Tue, 14 Aug 2012 19:58:41 GMT
Server: Apache/2.2.20 (Unix) mod_ssl/2.2.20 OpenSSL/0.9.8e-fips-rhel5 mod_auth_passthrough/2.1 mod_bwlimited/1.4 FrontPage/5.0.2.2635
X-Powered-By: PHP/5.2.17
Cache-Control: private
Pragma: private
X-UA-Compatible: IE=7
Set-Cookie: bblastvisit=1344974321; expires=Wed, 14-Aug-2013 19:58:41 GMT; path=/
Set-Cookie: bblastactivity=0; expires=Wed, 14-Aug-2013 19:58:41 GMT; path=/
Content-Type: text/html; charset=ISO-8859-1

Captured Content of Scenerockers.net

No Content Available

Scenerockers.net Similar Domains

Website DomainIP

car.eu

78.46.105.147

powergasket.com

69.43.160.151

shortterm-paydayloans.co.uk

87.106.241.94

****listing.com

64.210.149.41

tripntale.com

174.129.231.105

veniceapartments.org

62.75.191.142

l****liance.org

88.191.84.8

mysamp.de

85.13.130.181

medicinari.com

217.26.70.150

ari-led.de

80.237.132.204

****caribbeanholidays.com

69.175.77.162

onlinefriendship.co.in

69.167.179.22

gymexile.com

217.160.10.62

benandjessgethitched.com

67.20.115.197

WHOIS Record of Scenerockers.net

Importance of this data:

Every website has an owner, and that owner is the regitrant of that domain. The information given by the registrant while registering the domain is recorded by the registrar and that information is publicly available to everyone who wants to see that info. This information is also known as whois information. This information includes the name of the registrant and his address, his phone number and other contact information of his residence, technical and his business information.

=-=-=-=

Registration Service Provided By: Namecheap.com
Contact: support@namecheap.com
Visit: http://namecheap.com

Domain name: scenerockers.net

Registrant Contact:
WhoisGuard
WhoisGuard Protected ()

Fax:
11400 W. Olympic Blvd. Suite 200
Los Angeles, CA 90064
US

Administrative Contact:
WhoisGuard
WhoisGuard Protected (423b46bd47724001862443c02f150587.protect@whoisguard.com)
+1.6613102107
Fax: +1.6613102107
11400 W. Olympic Blvd. Suite 200
Los Angeles, CA 90064
US

Technical Contact:
WhoisGuard
WhoisGuard Protected (423b46bd47724001862443c02f150587.protect@whoisguard.com)
+1.6613102107
Fax: +1.6613102107
11400 W. Olympic Blvd. Suite 200
Los Angeles, CA 90064
US

Status: Locked

Name Servers:
dns01.privatelayer.com
dns02.privatelayer.com

Creation date: 01 Jan 2011 11:25:00
Expiration date: 01 Jan 2013 06:25:00




=-=-=-=
The data in this whois database is provided to you for information
purposes only, that is, to assist you in obtaining information about or
related to a domain name registration record. We make this information
available "as is," and do not guarantee its accuracy. By submitting a
whois query, you agree that you will use this data only for lawful
purposes and that, under no circumstances will you use this data to: (1)
enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or (2) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic
mail, or by telephone. The compilation, repackaging, dissemination or
other use of this data is expressly prohibited without prior written
consent from us.

We reserve the right to modify these terms at any time. By submitting
this query, you agree to abide by these terms.
Version 6.3 4/3/2002
 
Refreshing Data
We are gathering fresh data for scenerockers.net
Please wait while the update finishes. You will be returned to the previous page automatically.

Recent Recently Analyzed